PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold04312-snap-gene-0.20-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 433aa    MW: 48924.3 Da    PI: 4.5657
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold04312-snap-gene-0.20-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM134.28.6e-4291362128
                                        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkk 67 
                                                 pG+rF+Ptd+el+++yLk k +g++++ ++ ++ +di+k+ePwdLp  +++ +++k wy+F++++ +
  maker-scaffold04312-snap-gene-0.20-mRNA-1   9 LPGYRFSPTDDELIDDYLKLKKTGNDNKNTRRLPVIDICKYEPWDLPsfARIPTKDKVWYYFTEQSLR 76 
                                                59************************999899***************644888899************ PP

                                        NAM  68 yatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                +++g+ knr+t++gyWk tg+d++++s +g+++g+kktLv+++gr+p+ge t+ v+hey+ 
  maker-scaffold04312-snap-gene-0.20-mRNA-1  77 HKKGNSKNRSTEKGYWKPTGTDRKIMS-GGKVIGMKKTLVYHSGRSPNGEGTKYVIHEYHT 136
                                                ***************************.9******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100543.3818158IPR003441NAC domain
SuperFamilySSF1019411.09E-438156IPR003441NAC domain
PfamPF023654.9E-2110135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MDDPDLYSLP GYRFSPTDDE LIDDYLKLKK TGNDNKNTRR LPVIDICKYE PWDLPSFARI  60
PTKDKVWYYF TEQSLRHKKG NSKNRSTEKG YWKPTGTDRK IMSGGKVIGM KKTLVYHSGR  120
SPNGEGTKYV IHEYHTTKEF DAKHPGQEDL VLIRLFDNRE KSTKGGPAVS LDTTFCIEEA  180
KSKSSLAPVS PALQAETSDQ SYYVNISDEM LSDATAPVQC KTDNYNYHNA YVPEKQEAEM  240
TSSEDGFNVD KMMSDATEPV QFKNDNYNYH DAYVAEKQNA EMTSSEDDCN VEKYLNMFSP  300
SAFDFNADKM MFDATALVPF KNDNFNSEVD FNVEENLNKF CFTPPYDSPL SLPLITPDVS  360
AQSMLVPASV SPELGSEADN YPRCCPAESS DGITSSTIPP IEYNGYYTYV SKKEVAEIAS  420
DEVRKELNSS IKQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-291016417174Stress-induced transcription factor NAC1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20652586
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.22e-46NAC 014